Friday, March 6, 2026

The Etymology of swot

From the Oxford English Dictionary

According to the mathematician T. S. Davies (Notes & Queries, 1850), the term originated at the Royal Military College, Sandhurst, earlier at Great Marlow, in the early 19th century and was coined by students in the class of William Wallace, instructor in mathematics at this institution from 1803 to 1819:  ‘Wallace..had a bald head, and an exceedingly ‘broad Scotch’ accent... It happened on one hot summer's day..that he had been teaching a class, and had worked himself into a considerable effusion from the skin.  He took out his handkerchief, rubbed his head and forehead violently, and exclaimed in his Perthshire dialect, — "It maks one swot."  This was a God-send to the ‘gentlemen cadets’, wishing to achieve a notoriety as wits and slangsters; and mathematics generally ever after became swot, and mathematicians swots.  I have often heard it said:— "I never could do swot well, Sir"; and "these dull fellows, the swots, can talk of nothing but triangles and equations".’

William Wallace (1768–1843), was in fact from Fife, although he had previously taught at Perth Academy from 1794 to 1803; he went on to become professor of mathematics at Edinburgh University.
(OED)

𓐵


A  B  C  D  E  F  G  H  I  J  K  L  M  N  O  P  Q  R  S  T  U  V  W  X-Y  Z
𓐵

Thursday, June 12, 2025

AI for Logophiles

Whenever I have asked AI to define a term, I typically get a fairly good definition.  Sometimes it's a bit long, sometimes a bit short, but an experienced user can refine these results down to what is needed.  This is to be expected.

Here we are using AI simply as a newfangled dictionary.  And there's no real magic in that.

That is to say, we have a word and we need a definition.  But for me, I sometimes have a definition and need a word.  Sometimes I know that the word exists, and sometimes I have no idea if there is such a term.

So I ask Grok:  Is there a term for....

Sometimes it spits out the exact word I'm looking for immediately.  Sometimes this also takes a bit of refinement.  But it always works.

So the next time there is a word on the tip-of-your-tongue, just tell AI what you know, and ask:  Is there a word for that?
𓐵

A  B  C  D  E  F  G  H  I  J  K  L  M  N  O  P  Q  R  S  T  U  V  W  X-Y  Z
𓐵

Monday, May 19, 2025

Terms of Responsibilities



Grok Notes

Brief
Typically a concise summary or short document that outlines key points, instructions, or the scope of a project or task.  It is meant to convey essential information quickly and efficiently.
Usage:  You might receive a brief from a manager about a new project, which would include objectives, timelines, and key deliverables.

Purview
Refers to the scope or range of someone's responsibilities, knowledge, or authority.  It is about what falls within one's area of concern or expertise.
Usage:  For example, if someone says something is within my purview, they mean it is within their area of responsibility or knowledge.  It could be used in discussions about organizational roles or academic fields.

Remit
Generally denotes the tasks or duties that someone is officially assigned to handle.  It is similar to purview but often emphasizes more on the official or formal aspect of duties or areas of operation.
Usage:  An organization might have a remit to improve community health services, meaning that is the boundary of their operational mandate or focus.  It is commonly used in business or governmental contexts to define what an entity or individual is supposed to do or oversee.

Key Differences

Scope and Focus
Brief is about the content or information being communicated succinctly.
Purview and remit deal with areas of responsibility or authority, but:
Purview leans towards the natural or inherent scope of one's role or knowledge.
Remit suggests a more formal or assigned set of duties or operational boundaries.

Contextual Use
brief is often a document or verbal summary.
Purview often comes up when discussing whether something falls under someone's expertise or jurisdiction.
Remit is used when discussing formal roles, mandates, or tasks within organizations or systems.
(Grok)

Definitions:  briefpurviewremit
𓐵

A  B  C  D  E  F  G  H  I  J  K  L  M  N  O  P  Q  R  S  T  U  V  W  X-Y  Z
𓐵

Wednesday, April 2, 2025

Terms to describe using few words



Grok Notes

Laconic  Using very few words, often to the point of seeming rude or mysterious.  Connotation:  This term often implies efficiency, brevity, or even wit.  It comes from Laconia, the region of Sparta, known for the Spartans' terse speech.

Pauciloquent  Using few words in speech; being economical with words.  Connotation:  This term is less commonly used and might be seen in more scholarly or obscure contexts.  It focuses on the use of language in terms of quantity, similar to laconic, but without the cultural or historical connotation.

Taciturn  Characterized by a tendency to be silent or uncommunicative; reluctant to join in conversation.  Connotation:  Suggests a habitual disposition or personality trait rather than a choice for a specific moment.  It implies a natural or habitual silence, possibly due to shyness, reserve, or even sullenness.

Summary  Laconic emphasizes brevity, often with an implication of cleverness or directness.  Pauciloquent focuses purely on the minimal use of words without specifying the reason or the nature of the silence.  Taciturn describes a person's general disposition towards silence or minimal talking.  Each term provides a slightly different nuance on the concept of using few words, shaped by context, connotation, and the speaker's intent or nature.

Definitions:  laconicpauciloquenttaciturn
𓐵

A  B  C  D  E  F  G  H  I  J  K  L  M  N  O  P  Q  R  S  T  U  V  W  X-Y  Z
𓐵

Friday, March 21, 2025

Mass Psychosis and Hysteria



Grok Notes

Mass Formation Psychosis
A term used to describe a phenomenon where a large group of people share a common psychological state, often characterized by irrational beliefs or behavior.  It was notably used by psychologist Mattias Desmet to describe societal responses to certain events, like pandemics or political movements.
Characteristics
Involves a collective hypnosis or trance-like state among individuals, leading to conformity to a narrative or ideology.
Often linked to the concept of totalitarian thinking, where dissent is suppressed, and there's a strong group identity.
It implies a more structured, possibly manipulated, psychological response to societal conditions.

Mass Hysteria
Also known as collective hysteria, this is a phenomenon where a group of people exhibit similar physical symptoms or behaviors for which no physiological explanation can be found, often triggered by stress or perceived threats.
Characteristics:
Can manifest as physical symptoms like fainting, seizures, or other ailments, without medical cause.
Typically, it spreads rapidly through suggestion or social influence within a confined group or community.
It's more about immediate, physical reactions rather than long-term ideological conformity.

Social Contagion
This refers to the spread of behaviors, emotions, or conditions through a crowd or social network, often without direct personal contact or clear reason.
Characteristics:
Includes phenomena like the spread of laughter, panic, or even suicide clusters, where behaviors or emotions are transmitted through observation or interaction.
Can occur through various mediums, including social media, leading to the rapid dissemination of ideas or actions across large populations.
Unlike mass hysteria, the symptoms or behaviors might not be purely psychosomatic but include social behaviors or trends.

Key Differences

Scope and Nature
Mass Formation Psychosis involves a deeper, possibly manipulated, psychological state aimed at ideological conformity.
Mass Hysteria is more about immediate, often physical, reactions to perceived threats or stress.
Social Contagion focuses on the transmission of behaviors or emotions across social groups, not necessarily linked to a specific event or ideology.

Mechanism:
Mass Formation Psychosis might involve deliberate manipulation of narratives or information.
Mass Hysteria can emerge from a shared environment or event without deliberate manipulation.
Social Contagion leverages social interactions and networks for spread, often without any physical symptoms.

Outcome:
Mass Formation Psychosis could lead to or be part of broader societal changes or movements.
Mass Hysteria generally subsides once the perceived threat or stressor is removed or addressed.
Social Contagion might influence public health, behavior, or cultural trends in both short and long term.

These concepts can sometimes overlap, but each has distinct elements in how they manifest, spread, and impact society.
(Grok)

𓐵

A  B  C  D  E  F  G  H  I  J  K  L  M  N  O  P  Q  R  S  T  U  V  W  X-Y  Z
𓐵

Tuesday, February 4, 2025

Government Intentional Link Rot

Grok Notes

Government intentional link rot
 is not a formally defined term, but it can be understood as a subset of link rot where government entities deliberately allow or cause hyperlinks to break or become inaccessible, often by removing, relocating, or neglecting to maintain online content.  This could stem from policy decisions, budget constraints, or even intentional efforts to limit access to certain information—though proving intent is tricky without clear evidence.

Standard link rot is typically an organic process driven by the internet’s impermanence:  Websites get updated, servers shut down, or domains expire. When it involves government sites—like those with .gov domains—it often reflects practical issues, such as outdated infrastructure or lack of digital preservation strategies.  For example, a 2024 Pew Research study found that 21% of government webpages sampled in 2023 had at least one broken link, with local government sites being particularly prone.  Older pages, like those from 2013, were inaccessible 38% of the time by 2023, suggesting neglect rather than malice.

The intentional angle implies agency beyond mere oversight.  This could happen if a government removes politically sensitive documents, archives them offline, or lets links lapse to obscure historical records.  Imagine a controversial policy report quietly vanishing from a public server—no announcement, just a 404 error.  There’s no smoking gun in recent data proving this happens systematically, but anecdotal cases exist.  For instance, during website redesigns, agencies might not prioritize archiving old content, effectively burying it.  Critics might argue this serves to dodge accountability, though it is often framed as bureaucratic inertia.

On the flip side, governments are not always passive.  Some actively censor or scrub content—think of authoritarian regimes taking down dissent-friendly sites.  In democracies, it is subtler:  Shifting priorities or legal mandates might lead to defunded archives.  The U.S. Government Accountability Office noted in 2024 that federal fraud data from 2018-2022 was hard to consolidate partly due to inconsistent digital record-keeping, hinting at systemic issues that could foster intentional or unintentional rot.

Governments could use link rot as a tactic to hide or censor info, and it is not hard to see how.  Imagine a government quietly letting a sensitive report’s webpage lapse—say, by not renewing a domain, shuffling servers, or just accidentally breaking the URL during a redesign.  No public announcement, no paper trail, just a 404 error where evidence of, say, budget missteps or policy flops used to live. It is not overt censorship like banning a book or blocking a site with a firewall—it’s subtler, passive, and deniable.  Oops, technical glitch, they could shrug, while the info vanishes from easy reach.

The mechanics are simple enough.  Governments control their own .gov domains and servers, so they can decide what stays live or gets archived—or does not.  If a page is not preserved by something like the Internet Archive’s Wayback Machine (and even that’s not foolproof if they block crawlers), it is gone unless someone saved a PDF.  Add in the natural chaos of bureaucracy—underfunded IT, staff turnover, or shifting priorities—and intentional neglect could easily masquerade as incompetence.  A 2024 Pew Research study showed 38% of government pages from 2013 were inaccessible by 2023, mostly due to poor upkeep.  How many of those were conveniently inconvenient to maintain?

There is precedent for suspicion.  China’s government has pressured publishers to take down academic articles, effectively causing targeted link rot for specific content.  In the U.S., critics have accused agencies of scrubbing climate change data from sites during political shifts—less link rot by neglect, more link pruning by design.  On X, users in 2024 speculated about a Canadian tax data purge post-election, though I couldn’t pin down hard proof.  The line between sloppy digital housekeeping and deliberate erasure blurs fast when motives align.

Could it be systematic?  Sure.  A government wanting to dodge accountability might not need a grand conspiracy—just a memo to let certain archives expire.  No law says they have to keep every page live forever.  But proving it is a tactic versus just the web’s decay is the kicker.  Without leaked orders or whistleblowers, it is circumstantial—plausible, not confirmed.  Still, the capability’s there, and the incentive’s obvious.

Definition:  link rot
𓐵

A  B  C  D  E  F  G  H  I  J  K  L  M  N  O  P  Q  R  S  T  U  V  W  X-Y  Z
𓐵

Friday, January 3, 2025

The natives are getting restless

Grok Notes

Where does the phrase, "The natives are getting restless" come from?

The phrase the natives are getting restless is an idiomatic expression that likely originated in the context of colonial or imperial settings, particularly during the 19th and early 20th centuries.  It was often used by European colonizers or explorers to describe a growing sense of unease, impatience, or agitation among the indigenous populations they encountered or governed.  The term natives referred to the local inhabitants of colonized regions, while restless implied a brewing discontent or potential for uprising against foreign control.

Though pinpointing an exact origin is tricky, since it emerged organically in English vernacular, its usage aligns with the period of British and other European colonial expansion, especially in Africa, Asia, and the Americas.  It carries a somewhat condescending or paternalistic tone, reflecting the perspective of outsiders viewing indigenous people as unpredictable or subordinate.  The phrase gained broader traction in popular culture, including literature, film, and casual speech, often detached from its original colonial context.

By the mid-20th century, it started appearing in more ironic or humorous contexts, like in movies or books depicting explorers in exotic lands, sometimes with a clichéd drumbeat in the background to signal trouble brewing.  Today, it is often used metaphorically to describe any group growing impatient or unruly, stripped of its historical baggage for most speakers.  Without a single definitive source, it is best understood as a linguistic relic of colonial attitudes that evolved into a general figure of speech.


What would a definition of its modern usage be?

In modern usage, the natives are getting restless is a colloquial phrase that means a group of people, often subordinates, onlookers, or those waiting for something, are becoming impatient, agitated, or dissatisfied with a situation.  It is typically used in a lighthearted or slightly sarcastic way to suggest that restlessness is building, often due to delays, inaction, or unmet expectations.  The natives part no longer specifically refers to indigenous people but rather any collective group, like employees, an audience, or even friends waiting around.

For example, someone might say it during a long meeting, The natives are getting restless—better wrap this up!, or when a crowd starts grumbling at a delayed event.  The phrase keeps a hint of its original dramatic flair but is now more about everyday impatience than serious unrest.


Was this phrase, in historical or modern context, ever used in literature?

Yes, the phrase the natives are getting restless (or close variations) has appeared in literature, both in its historical colonial context and in modern, more metaphorical uses.  While it does not always show up verbatim in famous works, its sentiment and phrasing echo through texts that reflect colonial encounters or restless group dynamics.

Historically, the phrase aligns with the tone of 19th- and early 20th-century adventure and colonial literature.  For instance, authors like Rudyard Kipling, Joseph Conrad, or H. Rider Haggard, whose works often depict tense interactions between European outsiders and local populations, capture the kind of atmosphere where such a line could fit.  In Haggard’s King Solomon’s Mines (1885), there is no exact quote, but the recurring theme of wary explorers sensing agitation among African tribes mirrors the phrase’s colonial roots.  Similarly, Conrad’s Heart of Darkness (1899) conveys a brooding unease among the natives under European control, though the phrase itself is not used.  It is more a staple of the era’s vernacular that writers might have assumed readers understood.

In modern literature, the phrase shifts to a broader, often ironic usage.  It pops up in dialogue or narration to signal impatience or brewing chaos in a variety of settings.  For example, in Terry Pratchett’s Guards! Guards! (1989), a satirical fantasy novel, the line does not appear verbatim, but the restless discontent of Ankh-Morpork’s citizens carries a similar vibe, Pratchett’s humor could easily have spun it into a quip.  More explicitly, contemporary novels or scripts might use it for comedic effect, like in detective stories or workplace dramas where a character notes a crowd or team growing antsy.

The phrase also found a home in 20th-century pulp fiction and Hollywood tie-ins, where it became a trope for explorers or soldiers in exotic lands.  Think of old adventure serials or B-movies, lines like it often punctuated scenes with drums and torch-waving locals.  In print, pulp magazines like Argosy or Adventure from the 1920s-1940s occasionally leaned on such stock phrases to heighten tension.

So, while it is not a hallmark quote from a single iconic work, its presence in literature spans both serious historical tones and lighter modern riffs, evolving from a colonial observation to a versatile idiom.


So if this is used to describe people, of say a third world country, how would it be received?

Using the natives are getting restless to describe people in a third-world country today would likely be received poorly, depending on the context and audience.  The phrase’s colonial origins, tied to a history of European domination and a condescending view of indigenous or non-Western populations, give it a loaded undertone.  If said by an outsider, like a Westerner, about people in, say, an African, Asian, or Latin American nation, it could easily come off as patronizing, racist, or dismissive of their agency.  It risks implying that the people are primitive or unruly, echoing outdated stereotypes from the imperial era.

In casual speech or writing, even if meant jokingly, it might still stir unease or offense, especially among those aware of its historical baggage or sensitive to postcolonial dynamics.  For example, a journalist or politician using it to describe unrest in a developing country could face backlash for insensitivity, think social media pile-ons or accusations of neo-colonial attitudes.  In 2025, with global awareness of cultural nuance higher than ever, the phrase’s old-world vibe would not fly under the radar easily.

That said, reception depends on intent and delivery.  If it is clearly ironic or self-aware, like a local satirist using it to mock their own community’s impatience, it might land as humor.  But from an external perspective, particularly from a position of privilege, it is a minefield.  Most would see it as punching down or trivializing complex social realities, like poverty or political instability, reducing them to a cliché.  Safer to skip it altogether in that context; modern alternatives like people are getting fed up dodge the baggage while keeping the point.

𓐵

A  B  C  D  E  F  G  H  I  J  K  L  M  N  O  P  Q  R  S  T  U  V  W  X-Y  Z
𓐵

Friday, December 6, 2024

Terms for Describing Nonsense



Grok Notes

Here's a breakdown of the key differences among these colorful terms, each used to describe nonsense, foolishness, or something lacking truth or value:

Balderdash  This term suggests nonsense or meaningless talk, often in a slightly playful or antiquated sense.  It implies something that is absurd or pretentious but not necessarily offensive.

Drivel  This word has a connotation of being particularly mindless or silly, often relating to speech or writing that lacks substance or coherence.  It can suggest a kind of continuous, aimless flow of words.

Guff  Generally used to describe bluster or boastful nonsense, often with an implication of exaggeration or insincerity.  It's a bit more informal and can be used in a context where someone is trying to deceive or impress with false bravado.

Malarkey  Popularized in American English, this term denotes insincere or exaggerated talk, often with a political or persuasive twist.  It suggests a knowing deceit or an attempt to mislead with fancy but empty words.

Piffle  Similar to balderdash, piffle refers to trivial or petty nonsense, often in a light-hearted, dismissive way. It's used when you want to express that something is of little importance or just not worth serious consideration.

Taradiddle  This is one of the more whimsical terms, suggesting a lie or pretentious nonsense, but with an old-fashioned charm.  It can be used for both a small fib or a more elaborate deception, but always with a sense of playfulness or quaintness.

Tripe  While it can be used for any kind of nonsense, tripe particularly emphasizes something as being worthless or of very low quality, almost like the offal (animal intestines) it is named after.  It carries a stronger sense of disgust or disdain for the nonsense being presented.

Each term has its nuances, often colored by the context in which it is used or the personality of the speaker.  They all share the common ground of dismissing what is said as not worth taking seriously, but they do so with different flavors of criticism or humor.

Definitions:  balderdashdrivelguffmalarkeypiffletaradiddletripe
𓐵

A  B  C  D  E  F  G  H  I  J  K  L  M  N  O  P  Q  R  S  T  U  V  W  X-Y  Z
𓐵

Monday, December 2, 2024

Terms for Foolish, Silly, and Stupid



Grok Notes

Used to describe someone considered foolish or silly:

Mooncalf
Origin:  Originally, it referred to a misshapen or monstrous birth, thought to be caused by the influence of the moon. Over time, it came to mean someone who is foolish or absent-minded, often with a dreamy or naive quality.
Usage:  Today, it's less commonly used but still implies a person who is somewhat detached from reality or overly credulous.

Ninnyhammer
Origin:  From "ninny" (a simpleton) and "hammer" (emphasizing the foolishness). This term has been around since at least the 16th century.
Usage:  It suggests a more pronounced level of foolishness or stupidity, often with a playful or quaint tone.  It is an archaic term, so it is not commonly heard in modern speech but can be found in historical texts or used for humorous effect.

Numpty
Origin:  A Scottish term, likely from numps, a variant of numskull, meaning a foolish person.
Usage:  It is a contemporary term in the UK, particularly in Scotland, used casually to describe someone who has done something silly or made a mistake in a light-hearted way.  It is less harsh than some other insults, often carrying an affectionate tone.

Pillock
Origin:  Etymology uncertain, but might relate to pill (a small ball or bullet) with the idea of someone being small-minded or insignificant.  It has been in use since at least the 16th century.
Usage:  In modern British English, it is used to describe someone who is foolish or annoying, often with a bit of contempt.  It can be considered mildly offensive, depending on context, but it's also used humorously among friends.

Summary
Mooncalf suggests a dreamy, naive fool.
Ninnyhammer implies a more pronounced, perhaps historically quaint, fool.
Numpty is a modern, casual term with a slight affectionate tone for someone who's made a silly mistake.
Pillock is often used with a bit more contempt or annoyance for someone foolish or irritating.
Each term has its own flavor and context in which it is most appropriately used, reflecting different aspects of foolishness or incompetence.

Definitions:  mooncalfninnyhammernumptypillock
𓐵

A  B  C  D  E  F  G  H  I  J  K  L  M  N  O  P  Q  R  S  T  U  V  W  X-Y  Z
𓐵

Monday, November 11, 2024

The difference between admonishment and admonition



Grok Notes

The terms admonishment and admonition are closely related, as both derive from the verb admonish, which means to warn, reprimand, or advise someone firmly.  However, there are subtle differences in their usage and connotation, largely depending on context.

Admonition
This is a noun that refers to the act of admonishing or the warning/advice itself. It often carries a sense of gentle or earnest counsel, though it can also imply a firm rebuke.  It is typically the more formal or abstract term, focusing on the content or nature of the warning.  For example:  She gave him an admonition to drive carefully emphasizes the warning or advice as a standalone statement.

Admonishment
Also a noun, this term tends to emphasize the act or process of delivering the warning or reprimand.  It can feel slightly more personal or direct, sometimes implying a stronger sense of correction or disapproval.  For example:  His admonishment stung because it was public highlights the experience or delivery of the rebuke.

In practice, the distinction is often minor, and the two can be interchangeable in many cases.  However, admonition leans toward the intellectual or formal, for example, a written caution or moral advice, while admonishment might evoke a more immediate, emotional, or disciplinary tone, for example, a verbal scolding.  Dictionaries like Merriam-Webster and Oxford English Dictionary treat them as near-synonyms, with usage trends showing admonition being slightly more common in formal writing.

If you are looking for a quick rule of thumb:  Use admonition for the what, the warning itself, and admonishment for the how, the act of giving it.  But context usually dictates the choice more than a hard rule.

Definitions:  admonishadmonition
𓐵

A  B  C  D  E  F  G  H  I  J  K  L  M  N  O  P  Q  R  S  T  U  V  W  X-Y  Z
𓐵

Friday, November 1, 2024

Specious and Spurious



Grok Notes on the terms specious and spurious

Both relate to misleading or false appearances, but they have nuanced differences in their connotations and usage:

Specious
Appearing to be true or correct but actually false or misleading. 
Connotation:  Often used to describe arguments or reasoning that seem plausible at first glance but are flawed upon closer examination.  It suggests a veneer of truthfulness or attractiveness that hides a lack of substance or validity.  Example:  The theory might sound specious because it aligns with popular belief, but it lacks empirical evidence.

Spurious
Not genuine, authentic, or true; not coming from the claimed, pretended, or proper source.
Connotation:  This term often implies something that is not just misleading but also counterfeit or falsely attributed.  It can refer to data, correlations, or even connections that are not genuinely related or derived from legitimate sources.  Example:  The study was criticized for including spurious data that did not relate to the actual research question.

Key Differences

Source of Misleading Nature:  Specious often refers to the deceptive quality of an argument or appearance, where the misleading aspect comes from how it's presented.  Spurious more directly suggests falseness in origin or authenticity.

Context of Use:  While both can be used in contexts of argumentation, specious is particularly apt for discussing deceptive reasoning or logic, whereas spurious might be used more broadly to describe anything from data to connections that are not genuine.

In summary, while both words deal with deception, specious focuses on appearances or arguments that deceive due to their plausible facade, and spurious emphasizes the inauthenticity or falseness of something in its essence or origin.

Definitions:  specious, spurious
𓐵

A  B  C  D  E  F  G  H  I  J  K  L  M  N  O  P  Q  R  S  T  U  V  W  X-Y  Z
𓐵

Monday, October 14, 2024

Terms Describing Wasteful Use of Time



Grok Notes

Dally  To act or move slowly; to waste time.  Often implies a playful or flirtatious wasting of time.

Dawdle  To take more time than necessary; to linger aimlessly.  Typically associated with being slow in movement or progress, especially in a way that shows a lack of urgency or purpose.

Dillydally  To waste time by being indecisive or by engaging in trivial activities; essentially a more emphatic version of dally.

Lollygag  Similar to dawdle or dally but often with a connotation of being leisurely or lounging around, sometimes with an implication of laziness or unproductiveness.

Tarry  To delay in action or departure; to linger or wait.  This term can sometimes imply a more deliberate or intentional delay, often for a reason.

Key Differences

Intent:  Tarry might suggest a delay with some purpose, whereas dallydawdle, and lollygag often imply a more aimless or unnecessary delay.  Dillydally particularly emphasizes indecision.

Tone:  Dally and lollygag can have a playful or light-hearted tone, especially dally when it involves flirtation.  Dawdle tends to be more neutral or mildly disapproving, focusing on the act of slow movement.  Dillydally can sound more impatient or frustrated.  Tarry might not carry the same playful or lazy connotation, suggesting perhaps a more justified delay.

Formality:  Tarry might sound slightly more formal or old-fashioned compared to the others, which are more colloquial.

With the exception of tarry, all of these terms are derogatory.  Tarry can be as well, but as Grok summarizes above, sometimes it is a legitimate delay.

Definitions:  dallydawdledillydallylollygagtarry
𓐵

A  B  C  D  E  F  G  H  I  J  K  L  M  N  O  P  Q  R  S  T  U  V  W  X-Y  Z
𓐵